Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  SOLUTION STRUCTURE OF THE METHANOCOCCUS THERMOLITHOTROPHICUS FKBP
 
Authors :  R. Suzuki, K. Nagata, M. Kawakami, N. Nemoto, M. Furutani, K. Adachi, T. Maruyama, M. Tanokura
Date :  12 Jun 02  (Deposition) - 10 Jun 03  (Release) - 24 Feb 09  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
Keywords :  Fkbp Fold, Ppiase, Isomerase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  R. Suzuki, K. Nagata, F. Yumoto, M. Kawakami, N. Nemoto, M. Furutani, K. Adachi, T. Maruyama, M. Tanokura
Three-Dimensional Solution Structure Of An Archaeal Fkbp With A Dual Function Of Peptidyl Prolyl Cis-Trans Isomerase And Chaperone-Like Activities
J. Mol. Biol. V. 328 1149 2003
PubMed-ID: 12729748  |  Reference-DOI: 10.1016/S0022-2836(03)00379-6
(for further references see the PDB file header)

(-) Compounds

Molecule 1 - FKBP
    ChainsA
    EC Number5.2.1.8
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET-11D
    Expression System StrainBL21(DE3)/PLYSS
    Expression System Taxid562
    Expression System Vector TypePLASMID
    MutationYES
    Organism ScientificMETHANOTHERMOCOCCUS THERMOLITHOTROPHICUS
    Organism Taxid2186
    SynonymFKBP-TYPE PEPTIDYL-PROLYL CIS-TRANS ISOMERASE

 Structural Features

(-) Chains, Units

  
NMR Structure (10x)

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (0, 0)

(no "Ligand,Modified Residues,Ions" information available for 1IX5)

(-) Sites  (0, 0)

(no "Site" information available for 1IX5)

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 1IX5)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 1IX5)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 1IX5)

(-) PROSITE Motifs  (1, 1)

NMR Structure (1, 1)
 PROSITEUniProtKBPDB
No.IDACDescriptionIDLocationCountLocation
1FKBP_PPIASEPS50059 FKBP-type peptidyl-prolyl cis-trans isomerase domain profile.FKBP_METTL8-99  1A:8-99

(-) Exons   (0, 0)

(no "Exon" information available for 1IX5)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:151
 aligned with FKBP_METTL | O52980 from UniProtKB/Swiss-Prot  Length:154

    Alignment length:151
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153 
           FKBP_METTL     4 LVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE 154
               SCOP domains d1ix5a_ A: Archaeal FKBP                                                                                                                                SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......eeee..ee........ee.hhhhhhhhh..........eeee......hhhhhhhhhh.......eeee................eehhhhhh........eeee....eeeeeeee..eeeee.........eeee........ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----FKBP_PPIASE  PDB: A:8-99 UniProt: 8-99                                                      ------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 1ix5 A   4 MVDKGVKIKVDYIGKLESGDVFDTSIEEVAKEAGIYAPDREYEPLEFVVGEGQLIQGFEEAVLDMEVGDEKTVKIPAEKAYGNRNEMLIQKIPRDAFKEADFEPEEGMVILAEGIPATITEVTDNEVTLDFNHELAGKDLVFTIKIIEVVE 154
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153 

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (1, 1)

NMR Structure

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 1IX5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 1IX5)

(-) Gene Ontology  (4, 4)

NMR Structure(hide GO term definitions)
Chain A   (FKBP_METTL | O52980)
molecular function
    GO:0016853    isomerase activity    Catalysis of the geometric or structural changes within one molecule. Isomerase is the systematic name for any enzyme of EC class 5.
    GO:0003755    peptidyl-prolyl cis-trans isomerase activity    Catalysis of the reaction: peptidyl-proline (omega=180) = peptidyl-proline (omega=0).
biological process
    GO:0006457    protein folding    The process of assisting in the covalent and noncovalent assembly of single chain polypeptides or multisubunit complexes into the correct tertiary structure.
    GO:0000413    protein peptidyl-prolyl isomerization    The modification of a protein by cis-trans isomerization of a proline residue.

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
(no "Ligands, Modified Residues, Ions" information available for 1ix5)
 
  Sites
(no "Sites" information available for 1ix5)
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 1ix5)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  1ix5
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  FKBP_METTL | O52980
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  5.2.1.8
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  FKBP_METTL | O52980
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 1IX5)

(-) Related Entries Specified in the PDB File

4668 4668 CONTAINS CHEMICAL SHIFTS