Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRPB2 ENZYMES
 
Authors :  F. Busch, C. Rajendran, P. Loeffler, R. Merkl, R. Sterner
Date :  25 Jul 14  (Deposition) - 18 Feb 15  (Release) - 18 Feb 15  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.94
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Enzyme Evolution, Functional Annotation, Tryptophan Synthase, Lyase (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  F. Busch, C. Rajendran, O. Mayans, P. Loffler, R. Merkl, R. Sterner
Trpb2 Enzymes Are O-Phospho-L-Serine Dependent Tryptophan Synthases
Biochemistry V. 53 6078 2014
PubMed-ID: 25184516  |  Reference-DOI: 10.1021/BI500977Y

(-) Compounds

Molecule 1 - TRYPTOPHAN SYNTHASE BETA CHAIN 2
    ChainsB, A
    EC Number4.2.1.20
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET
    Expression System Taxid562
    Expression System Vector TypePLASMID
    GeneTRPB2, SSO1145
    Organism ScientificSULFOLOBUS SOLFATARICUS P2
    Organism Taxid273057

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 3)

Asymmetric/Biological Unit (3, 3)
No.NameCountTypeFull Name
1PLP1Ligand/IonPYRIDOXAL-5'-PHOSPHATE
2PLR1Ligand/Ion(5-HYDROXY-4,6-DIMETHYLPYRIDIN-3-YL)METHYL DIHYDROGENPHOSPHATE
3SEP1Mod. ResiduePHOSPHOSERINE

(-) Sites  (3, 3)

Asymmetric Unit (3, 3)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS B:110 , LYS B:111 , GLN B:138 , GLY B:262 , GLY B:263 , GLY B:264 , SER B:265 , ASN B:266 , ALA B:381 , GLU B:383 , SER B:412 , HOH B:623 , HOH B:671BINDING SITE FOR RESIDUE PLR B 501
2AC2SOFTWAREHIS A:110 , LYS A:111 , GLN A:138 , SER A:227 , GLY A:262 , GLY A:263 , GLY A:264 , SER A:265 , ASN A:266 , ALA A:381 , GLU A:383 , SER A:412 , SEP A:502BINDING SITE FOR RESIDUE PLP A 501
3AC3SOFTWARELYS A:111 , THR A:134 , GLY A:135 , ALA A:136 , GLY A:137 , GLN A:138 , TRP A:139 , GLY A:336 , LEU A:337 , ARG A:338 , GLU A:383 , PLP A:501BINDING SITE FOR RESIDUE SEP A 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 4QYS)

(-) Cis Peptide Bonds  (7, 7)

Asymmetric/Biological Unit
No.Residues
1Glu B:41 -Leu B:42
2Arg B:77 -Pro B:78
3Ser B:183 -Pro B:184
4Arg A:77 -Pro A:78
5Ser A:183 -Pro A:184
6Leu A:205 -Gly A:206
7Lys A:218 -Asn A:219

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 4QYS)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 4QYS)

(-) Exons   (0, 0)

(no "Exon" information available for 4QYS)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:408
                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author ..ee..hhhhh..eee.hhhhh..............hhhhhhhhhhhhhhhh.....eee.hhhhhhhhhhh.....eeehhhhhhhh...eeeeeee.hhh.....hhhhhhhhhhhhhh.....eeeee..hhhhhhhhhhhhhh...eeeee.hhhhhhhhhhhhhhhhh..eeee......hhhhhhhhhhhh....ee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhheeeee..........eeeee....................hhhhhhhhhh..eeeeeehhhhhhhhhhhhhhhhh.....hhhhhhhhhhhhhhhhhhhh..eeeeeee......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 4qys A   4 RIRIDLPQDEIPAQWYNILPDLPEELPPPQDPTGKSLELLKEVLPSKVLELEFAKERYVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEVHPSPSDLLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAGMEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMTKGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLISKGIVQARDYSQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLGNYASVLFK 428
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183   ||  210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420        
                                                                                                                                                                                                                 187|                                                                                                                                                                                                                               
                                                                                                                                                                                                                  205                                                                                                                                                                                                                               

Chain B from PDB  Type:PROTEIN  Length:418
                                                                                                                                                                                                                                                                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..ee..hhhhh..eee.hhhhh...............hhhhhhhhh....eee.hhhhhhhhhhh.....eeehhhhhhhh...eeeeeee.hhh.....hhhhhhhhhhhhhhh....eeeee..hhhhhhhhhhhhhh...eeeeeehhhhhhhhhhhhhhhhh..eeeee....hhhhhhhhh.......hhhhhhhhhhhhhhhh..ee.....hhhhhhhhhhhhhhhhhhhhhh.....eeeee...hhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhheeeee..........eeeee....................hhhhhhhhhh..eeeeeehhhhhhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhh....eeeeeee...hhhhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 4qys B   4 RIRIDLPQDEIPAQWYNILPDLPEELPPPQELLKEVLPSKVLELEFAKERYVKIPDEVLERYLQVGRPTPIIRAKRLEEYLGNNIKIYLKMESYTYTGSHKINSALAHVYYAKLDNAKFVTTETGAGQWGSSVALASALFRMKAHIFMVRTSYYAKPYRKYMMQMYGAEVHPSPSDLTEFGRQLLAKDSNHPGSLGIAISDAVEYAHKNGGKYVVGSVVNSDIMFKTIAGMEAKKQMELIGEDPDYIIGVVGGGSNYAALAYPFLGDELRSGKVRRKYIASGSSEVPKMTKGVYKYDYPDTAKLLPMLKMYTIGSDFVPPPVYAGGLRYHGVAPTLSLLISKGIVQARDYSQEESFKWAKLFSELEGYIPAPETSHALPILAEIAEEAKKSGERKTVLVSFSGHGLLDLGNYASVLFK 428
                                    13        23        33|       50        60        70        80        90       100       110       120       130       140       150       160       170       180       190       200       210       220       230       240       250       260       270       280       290       300       310       320       330       340       350       360       370       380       390       400       410       420        
                                                        33|                                                                                                                                                                                                                                                                                                                                                                                                   
                                                         41                                                                                                                                                                                                                                                                                                                                                                                                   

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 4QYS)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 4QYS)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 4QYS)

(-) Gene Ontology  (9, 9)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLR  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SEP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Arg A:77 - Pro A:78   [ RasMol ]  
    Arg B:77 - Pro B:78   [ RasMol ]  
    Glu B:41 - Leu B:42   [ RasMol ]  
    Leu A:205 - Gly A:206   [ RasMol ]  
    Lys A:218 - Asn A:219   [ RasMol ]  
    Ser A:183 - Pro A:184   [ RasMol ]  
    Ser B:183 - Pro B:184   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  4qys
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  TRPB2_SULSO | Q97TX6
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  4.2.1.20
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  TRPB2_SULSO | Q97TX6
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 4QYS)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 4QYS)