Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF ASPAT FROM CORYNEBACTERIUM GLUTAMICUM
 
Authors :  H. -F. Son, K. -J. Kim
Date :  31 Jan 16  (Deposition) - 24 Feb 16  (Release) - 24 Feb 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.00
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Aminotransferase, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  H. -F. Son, K. -J. Kim
Structural Insights Into A Novel Class Of Aspartate Aminotransferase From Corynebacterium Glutamicum
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - ASPARTATE AMINOTRANSFERASE
    Atcc: 13032
    Chains: A, B
    EC Number: 2.6.1.1
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Plasmid: PET30A
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 469008
    Expression System Vector Type: PLASMID
    Gene: ASPB, CG0294
    Organism Scientific: CORYNEBACTERIUM GLUTAMICUM (STRAIN ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025)
    Organism Taxid: 196627
    Strain: ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (5, 7)

Asymmetric/Biological Unit (5, 7)
No.NameCountTypeFull Name
1AKG1Ligand/Ion2-OXOGLUTARIC ACID
2GLU1Mod. Amino AcidGLUTAMIC ACID
3GOL3Ligand/IonGLYCEROL
4PLP1Ligand/IonPYRIDOXAL-5'-PHOSPHATE
5PMP1Ligand/Ion4'-DEOXY-4'-AMINOPYRIDOXAL-5'-PHOSPHATE

(-) Sites  (6, 6)

Asymmetric Unit (6, 6)
No.NameEvidenceResiduesDescription
1AC1SOFTWARESER A:103 , SER A:104 , LEU A:105 , TYR A:142 , VAL A:186 , ASN A:191 , ASP A:220 , ALA A:222 , TYR A:223 , SER A:256 , SER A:258 , LYS A:259 , AKG A:502 , HOH A:625 , HOH A:745 , TYR B:73binding site for residue PMP A 501
2AC2SOFTWAREGLY A:40 , TYR A:142 , ARG A:144 , LYS A:259 , PHE A:351 , PMP A:501 , HOH A:726 , HOH A:817 , TYR B:73binding site for residue AKG A 502
3AC3SOFTWAREARG A:13 , PHE A:17 , ASP A:20 , VAL A:345binding site for residue GOL A 503
4AC4SOFTWAREPHE B:189 , GLY B:194 , PHE B:195 , THR B:196 , PRO B:346 , ALA B:347 , HOH B:602 , HOH B:636 , HOH B:707binding site for residue GOL B 503
5AC5SOFTWAREALA B:336 , GLY B:339 , ALA B:341 , TRP B:343 , HOH B:650 , HOH B:661 , HOH B:747 , HOH B:759binding site for residue GOL B 504
6AC6SOFTWARETYR A:73 , ILE A:289 , ARG B:39 , GLY B:40 , LYS B:41 , SER B:103 , SER B:104 , LEU B:105 , TYR B:142 , ARG B:144 , VAL B:186 , ASN B:191 , ASP B:220 , ALA B:222 , TYR B:223 , SER B:256 , SER B:258 , LYS B:259 , ARG B:394 , HOH B:601 , HOH B:625 , HOH B:682 , HOH B:779binding site for Di-peptide PLP B 501 and GLU B 502

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5HXX)

(-) Cis Peptide Bonds  (6, 6)

Asymmetric/Biological Unit
No.Residues
1Leu A:56 -Pro A:57
2Val A:139 -Pro A:140
3Asn A:191 -Pro A:192
4Leu B:56 -Pro B:57
5Val B:139 -Pro B:140
6Asn B:191 -Pro B:192

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5HXX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5HXX)

(-) Exons   (0, 0)

(no "Exon" information available for 5HXX)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:424
                                                                                                                                                                                                                                                                                                                                                                                                                                                                        
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......hhhhhhhhhhhhhh......................hhhhhhhhhhhhh.hhh.eee...hhhhhhhhhhhhhhhhh......hhhhh...eeeeee..hhhhhhhhhhh..eeeeeeee..eehhhhhhhhh....eeeeee............hhhhhhhhhhh.......eeeee................hhhhhhhhh.....eeeeee...........eeee.hhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee........eeee....hhhhhhhhhhhh.ee.......hhhhh.....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hxx A   4 VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYANH 427
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423    


Chain B from PDB  Type:PROTEIN  Length:423
                                                                                                                                                                                                                                                                                                                                                                                                                                                                       
               SCOP domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhhhhhhh...ee......hhhhhhhhhhhhhh......................hhhhhhhhhhhhh.hhh.eee...hhhhhhhhhhhhhhhh.......hhhhh...eeeeee..hhhhhhhhhhh..eeeeeeee..eehhhhhhhhh....eeeeee............hhhhhhhhhhh.......eeeee................hhhhhhhhh.....eeeeee...........eeeeehhhhhhhhhhhhhhhh...hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..ee........eeee....hhhhhhhhhhhh.ee.......hhhhh.....eeee.....hhhhhhhhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5hxx B   4 VSLQDFDAERIGLFHEDIKRKFDELKSKNLKLDLTRGKPSSEQLDFADELLALPGKGDFKAADGTDVRNYGGLDGIVDIRQIWADLLGVPVEQVLAGDASSLNIMFDVISWSYIFGNNDSVQPWSKEETVKWICPVPGYDRHFSITERFGFEMISVPMNEDGPDMDAVEELVKNPQVKGMWVVPVFSNPTGFTVTEDVAKRLSAMETAAPDFRVVWDNAYAVHTLTDEFPEVIDIVGLGEAAGNPNRFWAFTSTSKITLAGAGVSFFLTSAENRKWYTGHAGIRGIGPNKVNQLAHARYFGDAEGVRAVMRKHAASLAPKFNKVLEILDSRLAEYGVAQWTVPAGGYFISLDVVPGTASRVAELAKEAGIALTGAGSSYPLRQDPENKNLRLAPSLPPVEELEVAMDGVATCVLLAAAEHYAN 426
                                    13        23        33        43        53        63        73        83        93       103       113       123       133       143       153       163       173       183       193       203       213       223       233       243       253       263       273       283       293       303       313       323       333       343       353       363       373       383       393       403       413       423
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5HXX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5HXX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5HXX)

(-) Gene Ontology  (5, 5)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    AKG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GLU  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    GOL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PLP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    PMP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Asn A:191 - Pro A:192   [ RasMol ]  
    Asn B:191 - Pro B:192   [ RasMol ]  
    Leu A:56 - Pro A:57   [ RasMol ]  
    Leu B:56 - Pro B:57   [ RasMol ]  
    Val A:139 - Pro A:140   [ RasMol ]  
    Val B:139 - Pro B:140   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5hxx
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  Q8NTR2_CORGL | Q8NTR2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  2.6.1.1
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  Q8NTR2_CORGL | Q8NTR2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/TrEMBL
        Q8NTR2_CORGL | Q8NTR2: 3ppl 5iwq

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5HXX)