Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CHAPERONE SPY BOUND TO IM7 6-45 ENSEMBLE
 
Authors :  S. Horowitz, L. Salmon, P. Koldewey, L. S. Ahlstrom, R. Martin, Q. Xu, P. V. Afonine, R. C. Trievel, C. L. Brooks, J. C. A. Bardwell
Date :  07 Mar 16  (Deposition) - 01 Jun 16  (Release) - 20 Jul 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.79
Chains :  Asym./Biol. Unit :  A,B,C
Keywords :  Chaperone (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  S. Horowitz, L. Salmon, P. Koldewey, L. S. Ahlstrom, R. Martin, S. Quan P. V. Afonine, H. Van Den Bedem, L. Wang, Q. Xu, R. C. Trievel, C. L. Brooks, J. C. Bardwell
Visualizing Chaperone-Assisted Protein Folding.
Nat. Struct. Mol. Biol. V. 23 691 2016
PubMed-ID: 27239796  |  Reference-DOI: 10.1038/NSMB.3237

(-) Compounds

Molecule 1 - SPHEROPLAST PROTEIN Y
    Chains: A, B
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Fragment: UNP RESIDUES 52-147
    Gene: SPY, B1743, JW1732
    Organism Scientific: ESCHERICHIA COLI (STRAIN K12)
    Organism Taxid: 83333
    Strain: K12
 
Molecule 2 - COLICIN-E7 IMMUNITY PROTEIN
    Chains: C
    Engineered: YES
    Fragment: UNP RESIDUES 6-45
    Organism Scientific: ESCHERICHIA COLI
    Organism Taxid: 562
    Synonym: IMME7,MICROCIN-E7 IMMUNITY PROTEIN
    Synthetic: YES

 Structural Features

(-) Chains, Units

  123
Asymmetric/Biological Unit : ABC

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 11)

Asymmetric/Biological Unit (2, 11)
No.NameCountTypeFull Name
1IMD3Ligand/IonIMIDAZOLE
2ZN8Ligand/IonZINC ION

(-) Sites  (11, 11)

Asymmetric Unit (11, 11)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREHIS A:65 , ASP A:66 , GLU A:120 , ZN A:202 , ZN A:205 , IMD A:207 , ARG B:62 , HIS B:65 , ASP B:66binding site for residue IMD A 201
02AC2SOFTWAREASP A:66 , IMD A:201 , ARG B:62 , ASP B:66 , HOH B:308binding site for residue ZN A 202
03AC3SOFTWAREASP A:71 , ASP A:74 , HOH A:353 , HOH A:378binding site for residue ZN A 203
04AC4SOFTWAREGLU A:86 , IMD A:208 , GLU B:79binding site for residue ZN A 204
05AC5SOFTWAREPHE A:119 , GLU A:120 , IMD A:201 , ARG B:61 , ARG B:62 , HIS B:65binding site for residue ZN A 205
06AC6SOFTWAREASP A:36 , GLU A:44 , HOH A:363binding site for residue ZN A 206
07AC7SOFTWAREARG A:62 , HIS A:65 , IMD A:201 , ZN A:209 , HIS B:65 , ASP B:66 , GLU B:120binding site for residue IMD A 207
08AC8SOFTWAREALA A:83 , GLU A:86 , ZN A:204 , HOH A:357 , VAL B:76 , GLU B:79binding site for residue IMD A 208
09AC9SOFTWAREARG A:61 , HIS A:65 , IMD A:207 , GLU B:120 , HOH B:344binding site for residue ZN A 209
10AD1SOFTWAREARG A:61 , MET A:64 , ILE A:68 , HIS B:96 , PHE B:119 , THR B:124binding site for residue ZN B 201
11AD2SOFTWAREGLU A:59 , ASP B:71 , HOH B:353binding site for residue ZN B 202

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5INA)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5INA)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5INA)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5INA)

(-) Exons   (0, 0)

(no "Exon" information available for 5INA)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:95
                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author hhhhhh.hhhhhhhhhhhhh.........hhhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------- Transcript
                 5ina A  28 SFKDLNLTDAQKQQIREIMKGQRDQMRPPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRL 123
                                    37        47     || 58        68        78        88        98       108       118     
                                                    53|                                                                    
                                                     55                                                                    


Chain B from PDB  Type:PROTEIN  Length:92
                                                                                                                            
               SCOP domains -------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhh.......hhhhhhhhhhh....hhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh..hhhhhhhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------- Transcript
                 5ina B  29 FKDLNLTDAQKQQIREIMKGQRMRPLEERRAMHDIIASDTFDKVKAEAQIAKMEEQRKANMLAHMETQNKIYNILTPEQKKQFNANFEKRLT 124
                                    38        48 ||||   62        72        82        92       102       112       122  
                                                50|||                                                                   
                                                 53||                                                                   
                                                  55|                                                                   
                                                   57                                                                   


Chain C from PDB  Type:PROTEIN  Length:37
                                                                     
               SCOP domains ------------------------------------- SCOP domains
               CATH domains ------------------------------------- CATH domains
               Pfam domains ------------------------------------- Pfam domains
         Sec.struct. author ..................................... Sec.struct. author
                 SAPs(SNPs) ------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------- PROSITE
                 Transcript ------------------------------------- Transcript
                 5ina C   6 SISDYEAEVQLLKEIEKENVAATDDVLDVLLEHFVKT  45
                                || |17        27        37     ||
                               10| ||                         43|
                                12 ||                          45
                                  14|                            
                                   16
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5INA)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5INA)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5INA)

(-) Gene Ontology  (7, 7)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    ZN  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ina)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ina
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
  SPY_ECOLI | P77754
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  IMM7_ECOLX | Q03708
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  SPY_ECOLI | P77754
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        IMM7_ECOLX | Q03708: 1ayi 1cei 1mz8 1ujz 1unk 1znv 2erh 2jaz 2jb0 2jbg 2k0d 4f37 7cei
        SPY_ECOLI | P77754: 5ioa 5ioe 5iog

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5INA)