Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)

(-) Description

Title :  ANTPHD WITH 15BP DNA DUPLEX S-MONOTHIOATED AT CYTIDINE-8
 
Authors :  M. A. White, L. Zandarashvili, J. Iwahara, D. Nguyen
Date :  27 Apr 16  (Deposition) - 22 Jun 16  (Release) - 14 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.75
Chains :  Asym. Unit :  A,B,C,D,E,F
Biol. Unit 1:  A,B,C  (1x)
Biol. Unit 2:  D,E,F  (1x)
Keywords :  Homeodomain, Dna-Binding Protein, Complex (Homeodomain-Dna), Transcription-Dna Complex, Transcription Regulator-Dna Complex, Monothiolated Dna (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  D. Nguyen, L. Zandarashvili, M. A. White, J. Iwahara
Stereospecific Effects Of Oxygen-To-Sulfur Substitution In Dna Phosphate On Ion Pair Dynamics And Protein-Dna Affinity
Chembiochem V. 17 1636 2016
PubMed-ID: 27271797  |  Reference-DOI: 10.1002/CBIC.201600265

(-) Compounds

Molecule 1 - HOMEOTIC PROTEIN ANTENNAPEDIA
    ChainsA, D
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System Taxid562
    GeneANTP, CG1028
    MutationYES
    Organism CommonFRUIT FLY
    Organism ScientificDROSOPHILA MELANOGASTER
    Organism Taxid7227
 
Molecule 2 - DNA (5'-D(*AP*GP*AP*AP*AP*GP*CP*(C7S) P*AP*TP*TP*AP*GP*AP*G)-3')
    ChainsB, E
    EngineeredYES
    Organism ScientificUNIDENTIFIED
    Organism Taxid32644
    SyntheticYES
 
Molecule 3 - DNA (5'-D(*TP*CP*TP*CP*TP*AP*AP*TP*GP*GP*CP*TP*TP*TP*C)- 3')
    ChainsC, F
    EngineeredYES
    Organism ScientificUNIDENTIFIED
    Organism Taxid32644
    SyntheticYES

 Structural Features

(-) Chains, Units

  123456
Asymmetric Unit ABCDEF
Biological Unit 1 (1x)ABC   
Biological Unit 2 (1x)   DEF

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 5)

Asymmetric Unit (2, 5)
No.NameCountTypeFull Name
1C7S2Mod. Nucleotide2'-DEOXY-5'-O-THIOPHOSPHONOCYTIDINE
2NI3Ligand/IonNICKEL (II) ION
Biological Unit 1 (1, 1)
No.NameCountTypeFull Name
1C7S1Mod. Nucleotide2'-DEOXY-5'-O-THIOPHOSPHONOCYTIDINE
2NI-1Ligand/IonNICKEL (II) ION
Biological Unit 2 (1, 1)
No.NameCountTypeFull Name
1C7S1Mod. Nucleotide2'-DEOXY-5'-O-THIOPHOSPHONOCYTIDINE
2NI-1Ligand/IonNICKEL (II) ION

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREHIS A:21 , HOH A:203 , HIS D:21 , LYS D:58 , ASN D:60 , HOH D:103binding site for residue NI A 101
2AC2SOFTWAREDG B:1binding site for residue NI B 101
3AC3SOFTWAREDG E:2 , HOH E:203binding site for residue NI E 101
4AC4SOFTWARETYR D:25 , GLN D:50 , ARG D:53 , MET D:54 , LYS D:57 , DG E:6 , DA E:9 , DG F:9 , DG F:10binding site for Di-nucleotide DC E 7 and C7S E 8
5AC5SOFTWAREMET D:54 , LYS D:57 , DC E:7 , DT E:10 , DA F:7 , DT F:8 , DG F:9binding site for Di-nucleotide C7S E 8 and DA E 9

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JLX)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5JLX)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JLX)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JLX)

(-) Exons   (0, 0)

(no "Exon" information available for 5JLX)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:57
                                                                                        
               SCOP domains --------------------------------------------------------- SCOP domains
               CATH domains --------------------------------------------------------- CATH domains
               Pfam domains --------------------------------------------------------- Pfam domains
         Sec.struct. author .....hhhhhhhhhhhhh.....hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) --------------------------------------------------------- SAPs(SNPs)
                    PROSITE --------------------------------------------------------- PROSITE
                 Transcript --------------------------------------------------------- Transcript
                  5jlx A  4 GRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN 60
                                    13        23        33        43        53       

Chain B from PDB  Type:DNA  Length:15
                                              
                  5jlx B  0 AGAAAGCxATTAGAG 14
                                   | 9     
                                   7-C7S   

Chain C from PDB  Type:DNA  Length:15
                                              
                  5jlx C  0 TCTCTAATGGCTTTC 14
                                     9     

Chain D from PDB  Type:PROTEIN  Length:58
                                                                                         
               SCOP domains ---------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------- Pfam domains
         Sec.struct. author ......hhhhhhhhhhhhhhh...hhhhhhhhhhhh..hhhhhhhhhhhhhhhhhhhh Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------- Transcript
                  5jlx D  3 RGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEN 60
                                    12        22        32        42        52        

Chain E from PDB  Type:DNA  Length:15
                                              
                  5jlx E  1 AGAAAGCxATTAGAG 15
                                   |10     
                                   8-C7S   

Chain F from PDB  Type:DNA  Length:15
                                              
                  5jlx F  1 TCTCTAATGGCTTTC 15
                                    10     

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JLX)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JLX)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JLX)

(-) Gene Ontology  (20, 20)

Asymmetric Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    C7S  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NI  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5jlx)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jlx
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  ANTP_DROME | P02833
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  ANTP_DROME | P02833
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        ANTP_DROME | P028331ahd 1hom 1kz0 1kz5 1omq 1san 2hoa 2nd6 2nd7 2nd8 4xic 4xid 5jlw 9ant

(-) Related Entries Specified in the PDB File

5jlw