Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  TRYPANOSOME BRUCEI HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANFERASE IN COMPLEX WITH GUANOSINE 5' MONOPHOSPHATE
 
Authors :  D. Teran, L. Guddat
Date :  10 May 16  (Deposition) - 09 Nov 16  (Release) - 09 Nov 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  2.73
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Complex, Dimer, Enzyme, Transferase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  D. Teran, D. Hockova, M. Cesnek, A. Zikova, L. Naesens, D. T. Keough, L. W. Guddat
Crystal Structures And Inhibition Of Trypanosoma Brucei Hypoxanthine-Guanine Phosphoribosyltransferase.
Sci Rep V. 6 35894 2016
PubMed-ID: 27786284  |  Reference-DOI: 10.1038/SREP35894

(-) Compounds

Molecule 1 - HYPOXANTHINE-GUANINE PHOSPHORIBOSYLTRANSFERASE
    Chains: A, B
    EC Number: 2.4.2.8
    Engineered: YES
    Expression System: ESCHERICHIA COLI
    Expression System Taxid: 562
    Gene: HGPRT
    Organism Scientific: TRYPANOSOMA BRUCEI BRUCEI
    Organism Taxid: 5702
    Synonym: HGPRTASE

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit : AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 10)

Asymmetric/Biological Unit (3, 10)
No.NameCountTypeFull Name
15GP2Ligand/IonGUANOSINE-5'-MONOPHOSPHATE
2MG4Ligand/IonMAGNESIUM ION
3SO44Ligand/IonSULFATE ION

(-) Sites  (10, 10)

Asymmetric Unit (10, 10)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREILE A:115 , ASP A:117 , LYS A:145 , VAL A:165 , PHE A:166 , VAL A:167 , LEU A:172 , ASP A:173 , SO4 A:302 , SO4 A:303 , MG A:304 , HIS B:0binding site for residue 5GP A 301
02AC2SOFTWAREGLU A:113 , ILE A:115 , ASP A:117 , THR A:118 , ALA A:119 , THR A:121 , LEU A:122 , 5GP A:301binding site for residue SO4 A 302
03AC3SOFTWARELYS A:54 , GLY A:55 , ASP A:173 , ARG A:179 , 5GP A:301 , MG A:304 , MG A:305 , HOH A:406binding site for residue SO4 A 303
04AC4SOFTWARE5GP A:301 , SO4 A:303 , MG A:305binding site for residue MG A 304
05AC5SOFTWAREASP A:173 , SO4 A:303 , MG A:304 , HOH A:420binding site for residue MG A 305
06AC6SOFTWAREHIS A:0 , ILE B:115 , ASP B:117 , LYS B:145 , VAL B:165 , PHE B:166 , VAL B:167 , LEU B:172 , ASP B:173 , SO4 B:302 , SO4 B:303 , MG B:305binding site for residue 5GP B 301
07AC7SOFTWAREGLU B:113 , ASP B:117 , THR B:118 , ALA B:119 , LEU B:120 , THR B:121 , 5GP B:301 , HOH B:420binding site for residue SO4 B 302
08AC8SOFTWARELYS B:54 , GLY B:55 , ASP B:173 , ARG B:179 , 5GP B:301 , MG B:304 , MG B:305 , HOH B:416binding site for residue SO4 B 303
09AC9SOFTWAREASP B:173 , SO4 B:303 , MG B:305binding site for residue MG B 304
10AD1SOFTWARE5GP B:301 , SO4 B:303 , MG B:304binding site for residue MG B 305

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5JV5)

(-) Cis Peptide Bonds  (2, 2)

Asymmetric/Biological Unit
No.Residues
1Leu A:53 -Lys A:54
2Leu B:53 -Lys B:54

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5JV5)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5JV5)

(-) Exons   (0, 0)

(no "Exon" information available for 5JV5)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:181
                                                                                                                                                                                                                     
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee..hhhhhhhhhhhhhhhh...eeeeee........eeeeeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.hhhh.......eeeee......................eeeehhhhhhhhhh.. Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jv5 A  -1 HHMEPACKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLRLCDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL 199
                                     8        18        28        38        48        58        68        78 ||    108       118       128       138       148       158       168       178       188       198 
                                                                                                            80|                                                                                                  
                                                                                                            101                                                                                                  


Chain B from PDB  Type:PROTEIN  Length:178
                                                                                                                                                                                                                  
               SCOP domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...........eeeeeehhhhhhhhhhhhhhhhhhhhhhhh.......eeeeee..hhhhhhhhhhhhhhhh...eeeeee.....eeeeeeeee..hhhhhhhhhhhhhhh..eeeeeeeee.hhhh.......eeeee......................eeeehhhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5jv5 B  -1 HHMEPACKYDFATSVLFTEAELHTRMRGVAQRIADDYSNCNLKPLENPLVIVSVLKGSFVFTADMVRILGDFGVPTRVEFLDIRGKHVLVLEDILDTALTLREVVDSLKKSEPASIKTLVAIDKPGGRKIPFTAEYVVADVPNVFVVGYGLDYDQSYREVRDVVILKPSVYETWGKEL 199
                                     8        18        28        38        48        58        68        78||     111       121       131       141       151       161       171       181       191        
                                                                                                           79|                                                                                                
                                                                                                           103
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5JV5)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5JV5)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5JV5)

(-) Gene Ontology  (10, 10)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    5GP  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    MG  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    SO4  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
    Leu A:53 - Lys A:54   [ RasMol ]  
    Leu B:53 - Lys B:54   [ RasMol ]  
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym./Biol. Unit PNG format | Asym./Biol. Unit - sites PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5jv5
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  2.4.2.8
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  HPRT_TRYBB | Q07010
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        HPRT_TRYBB | Q07010: 5jsq 5k51 5kam 5kap

(-) Related Entries Specified in the PDB File

5jsq 5k51 5kam 5kap