Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asymmetric Unit
(-)Asym. Unit - sites
(-)Biological Unit 1
(-)Biol. Unit 1 - sites
(-)Biological Unit 2
(-)Biological Unit 3
(-)Biological Unit 4
collapse expand < >
Image Asymmetric Unit
Asymmetric Unit  (Jmol Viewer)
Image Asym. Unit - sites
Asym. Unit - sites  (Jmol Viewer)
Image Biological Unit 1
Biological Unit 1  (Jmol Viewer)
Image Biol. Unit 1 - sites
Biol. Unit 1 - sites  (Jmol Viewer)
Image Biological Unit 2
Biological Unit 2  (Jmol Viewer)
Image Biological Unit 3
Biological Unit 3  (Jmol Viewer)
Image Biological Unit 4
Biological Unit 4  (Jmol Viewer)

(-) Description

Title :  SRTA SORTASE FROM ACTINOMYCES ORIS
 
Authors :  J. Osipiuk, X. Ma, H. Ton-That, W. F. Anderson, A. Joachimiak, Center F Structural Genomics Of Infectious Diseases (Csgid)
Date :  15 Feb 17  (Deposition) - 01 Mar 17  (Release) - 01 Mar 17  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.70
Chains :  Asym. Unit :  A,B,C,D
Biol. Unit 1:  A  (1x)
Biol. Unit 2:  B  (1x)
Biol. Unit 3:  C  (1x)
Biol. Unit 4:  D  (1x)
Keywords :  Structural Genomics, Center For Structural Genomics Of Infectious Diseases, Csgid, Hydrolase (Keyword Search: [Gene Ontology, PubMed, Web (Google)] )
 
Reference :  J. Osipiuk, X. Ma, H. Ton-That, W. F. Anderson, A. Joachimiak, Center For Structural Genomics Of Infectious Diseases (Csgid)
Srta Sortase From Actinomyces Oris
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - SORTASE
    Chains: A, B, C, D
    Engineered: YES
    Expression System: ESCHERICHIA COLI 'BL21-GOLD(DE3)PLYSS AG'
    Expression System Plasmid: PMCSG7
    Expression System Strain: BL21(DE3)
    Expression System Taxid: 866768
    Expression System Vector Type: PLASMID
    Fragment: RESIDUES 71-257
    Gene: AXE84_04905
    Organism Scientific: ACTINOMYCES ORIS
    Organism Taxid: 544580

 Structural Features

(-) Chains, Units

  1234
Asymmetric Unit : ABCD
Biological Unit 1 (1x): A   
Biological Unit 2 (1x):  B  
Biological Unit 3 (1x):   C 
Biological Unit 4 (1x):    D

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (1, 12)

Asymmetric Unit (1, 12)
No.NameCountTypeFull Name
1CL12Ligand/IonCHLORIDE ION
Biological Unit 1 (0, 0)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
Biological Unit 2 (0, 0)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
Biological Unit 3 (0, 0)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION
Biological Unit 4 (0, 0)
No.NameCountTypeFull Name
1CL-1Ligand/IonCHLORIDE ION

(-) Sites  (12, 12)

Asymmetric Unit (12, 12)
No.NameEvidenceResiduesDescription
01AC1SOFTWAREGLY A:218 , SER A:219 , THR A:220 , ALA A:221 , HOH A:692binding site for residue CL A 501
02AC2SOFTWARETHR A:118 , THR A:132 , ASP B:253 , HOH B:648binding site for residue CL A 502
03AC3SOFTWAREARG A:209binding site for residue CL A 503
04AC4SOFTWAREGLY B:218 , THR B:220 , ALA B:221 , HOH B:675binding site for residue CL B 501
05AC5SOFTWAREASN A:252 , ASP A:253 , THR B:118 , TYR B:131 , THR B:132 , HOH B:668binding site for residue CL B 502
06AC6SOFTWAREARG B:209binding site for residue CL B 503
07AC7SOFTWAREGLY C:218 , SER C:219 , THR C:220 , ALA C:221 , HOH C:663binding site for residue CL C 501
08AC8SOFTWARETHR C:118 , THR C:132 , ASN D:252 , ASP D:253binding site for residue CL C 502
09AC9SOFTWAREARG C:209binding site for residue CL C 503
10AD1SOFTWAREGLY D:218 , SER D:219 , THR D:220 , ALA D:221 , ASP D:227 , HOH D:682binding site for residue CL D 501
11AD2SOFTWAREASN C:252 , ASP C:253 , THR D:118 , TYR D:131 , THR D:132 , HOH D:633binding site for residue CL D 502
12AD3SOFTWAREARG D:209binding site for residue CL D 503

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5UTT)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5UTT)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5UTT)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5UTT)

(-) Exons   (0, 0)

(no "Exon" information available for 5UTT)

(-) Sequences/Alignments

Asymmetric Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it) 
Chain A from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeeeehhhhh......eeeee..hhhhhh...eee..........eeeeee...........hhhhh....eeeee...eeeeeeeeeeeee...hhhhhh............eeeeeeeee...hhhhh..eeeeeeeeeeeeee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5utt A  78 TKRTDAPPVMEQVGYGETIGMLVVPKWYGVTNNNMPIMEGTGSDVLDQAAAGHYTNTQQLGEVGNFAIAGHRRTYGNSFRRIDLLQEGDEIIVSTAKTWYVFKVTGHELVKPEQVEVIAPVPNQPDAQPTDRYITLTTCHGSTAGEFGNDLRWIVHAKFAYWMDRSEGRPESVLNDPGVN 257
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257


Chain B from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeeeehhhhh......eeeee..hhhhhh...eee..........eeeeee...........hhhhh....eeeee...eeeeeeeeeeeee...hhhhhh............eeeeeeeee...hhhhh..eeeeeeeeeeeeee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5utt B  78 TKRTDAPPVMEQVGYGETIGMLVVPKWYGVTNNNMPIMEGTGSDVLDQAAAGHYTNTQQLGEVGNFAIAGHRRTYGNSFRRIDLLQEGDEIIVSTAKTWYVFKVTGHELVKPEQVEVIAPVPNQPDAQPTDRYITLTTCHGSTAGEFGNDLRWIVHAKFAYWMDRSEGRPESVLNDPGVN 257
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257


Chain C from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeeeehhhhh......eeeee..hhhhhh...eee..........eeeeee...........hhhhh....eeeee...eeeeeeeeeeeee...hhhhhh............eeeeeeeee...hhhhh..eeeeeeeeeeeeee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5utt C  78 TKRTDAPPVMEQVGYGETIGMLVVPKWYGVTNNNMPIMEGTGSDVLDQAAAGHYTNTQQLGEVGNFAIAGHRRTYGNSFRRIDLLQEGDEIIVSTAKTWYVFKVTGHELVKPEQVEVIAPVPNQPDAQPTDRYITLTTCHGSTAGEFGNDLRWIVHAKFAYWMDRSEGRPESVLNDPGVN 257
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257


Chain D from PDB  Type:PROTEIN  Length:180
                                                                                                                                                                                                                    
               SCOP domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SCOP domains
               CATH domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ CATH domains
               Pfam domains ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Pfam domains
         Sec.struct. author .................eeeeeehhhhh......eeeee..hhhhhh...eee..........eeeeee...........hhhhh....eeeee...eeeeeeeeeeeee...hhhhhh............eeeeeeeee...hhhhh..eeeeeeeeeeeeee................ Sec.struct. author
                 SAPs(SNPs) ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ SAPs(SNPs)
                    PROSITE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ PROSITE
                 Transcript ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ Transcript
                 5utt D  78 TKRTDAPPVMEQVGYGETIGMLVVPKWYGVTNNNMPIMEGTGSDVLDQAAAGHYTNTQQLGEVGNFAIAGHRRTYGNSFRRIDLLQEGDEIIVSTAKTWYVFKVTGHELVKPEQVEVIAPVPNQPDAQPTDRYITLTTCHGSTAGEFGNDLRWIVHAKFAYWMDRSEGRPESVLNDPGVN 257
                                    87        97       107       117       127       137       147       157       167       177       187       197       207       217       227       237       247       257
   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5UTT)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5UTT)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5UTT)

(-) Gene Ontology  (0, 0)

Asymmetric Unit(hide GO term definitions)
    (no "Gene Ontology" information available for 5UTT)

 Visualization

(-) Interactive Views

Asymmetric Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CL  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
    AC6  [ RasMol ]  +environment [ RasMol ]
    AC7  [ RasMol ]  +environment [ RasMol ]
    AC8  [ RasMol ]  +environment [ RasMol ]
    AC9  [ RasMol ]  +environment [ RasMol ]
    AD1  [ RasMol ]  +environment [ RasMol ]
    AD2  [ RasMol ]  +environment [ RasMol ]
    AD3  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5utt)
 
Biological Units
  Complete Structure
    Biological Unit 1  [ Jena3D ]
    Biological Unit 2  [ Jena3D ]
    Biological Unit 3  [ Jena3D ]
    Biological Unit 4  [ Jena3D ]

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
[ Asym. Unit PNG format | Asym. Unit - sites PNG format | Biol. Unit 1 PNG format | Biol. Unit 1 - sites PNG format | Biol. Unit 2 PNG format | Biol. Unit 3 PNG format | Biol. Unit 4 PNG format ](automatic orientation, automatically generated)
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick
[ mono PDF format | stereo PDF format ](default orientation, automatically generated)

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5utt
    Family and Domain Information: ProDom | SYSTERS
    General Structural Information: GlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in Membranes: OPM
    Protein Surface: SURFACE
    Secondary Structure: DSSP (structure derived) | HSSP (homology derived)
    Structural Genomics: GeneCensus
    Structural Neighbours: CE | VAST
    Structure Classification: CATH | Dali | SCOP
    Validation and Original Data: BMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  A0A0X8K1J2_9 | A0A0X8K1J2
    Comparative Protein Structure Models: ModBase
    Genomic Information: Ensembl
    Protein-protein Interaction: DIP
    Sequence, Family and Domain Information: InterPro | Pfam | SMART | UniProtKB/TrEMBL
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme Information: BRENDA | EC-PDB | Enzyme | IntEnz
    Pathway: KEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease Information: OMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related Information: GenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain Information: XDom
    Interatomic Contacts of Structural Units: CSU
    Ligand-protein Contacts: LPC
    Protein Cavities: castP
    Sequence and Secondary Structure: PDBCartoon
    Structure Alignment: STRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence Browser: STING
 
Access by UniProt ID/Accession number
  A0A0X8K1J2_9 | A0A0X8K1J2
    Protein Disorder Prediction: DisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

(no "Entries Sharing at Least One Protein Chain" available for 5UTT)

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5UTT)