Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)NMR Structure - model 1
(-)NMR Structure - model 1, sites
(-)NMR Structure - all models
collapse expand < >
Image NMR Structure - model 1
NMR Structure - model 1  (Jmol Viewer)
Image NMR Structure - model 1, sites
NMR Structure - model 1, sites  (Jmol Viewer)
Image NMR Structure - all models
NMR Structure - all models  (Jmol Viewer)

(-) Description

Title :  THE NMR STRUCTURE OF CALMODULIN IN CTAB REVERSE MICELLES
 
Authors :  G. Xu, K. Cheng, Q. Wu, M. Liu, C. Li
Date :  16 Jun 16  (Deposition) - 28 Sep 16  (Release) - 28 Sep 16  (Revision)
Method :  SOLUTION NMR
Resolution :  NOT APPLICABLE
Chains :  NMR Structure  :  A  (10x)
NMR Structure *:  A  (1x)
Keywords :  Compact, Two-Domain, Signaling Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  G. Xu, K. Cheng, Q. Wu, M. Liu, C. Li
The Nmr Structure Of Calmodulin In Ctab Reverse Micelles
To Be Published
PubMed: search

(-) Compounds

Molecule 1 - CALMODULIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System StrainK-12
    Expression System Taxid83333
    GeneCALM, CAM
    MutationYES
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCAM

 Structural Features

(-) Chains, Units

  1
NMR Structure (10x)A
NMR Structure * (1x)A

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (2, 4)

NMR Structure (2, 4)
No.NameCountTypeFull Name
1CA3Ligand/IonCALCIUM ION
2TB1Ligand/IonTERBIUM(III) ION
NMR Structure * (0, 0)
No.NameCountTypeFull Name
1CA-1Ligand/IonCALCIUM ION
2TB-1Ligand/IonTERBIUM(III) ION

(-) Sites  (4, 4)

NMR Structure (4, 4)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:20 , ASP A:22 , ASP A:24 , THR A:26 , GLU A:31binding site for residue CA A 401
2AC2SOFTWAREASP A:93 , ASP A:95 , ASN A:97 , TYR A:99 , GLU A:104binding site for residue CA A 402
3AC3SOFTWAREASP A:129 , ASP A:131 , ASP A:133 , GLN A:135 , ASN A:137 , GLU A:140binding site for residue CA A 403
4AC4SOFTWAREASP A:56 , ASP A:58 , ASP A:60 , THR A:62 , GLU A:67binding site for residue TB A 404

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5GGM)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5GGM)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5GGM)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5GGM)

(-) Exons   (0, 0)

(no "Exon" information available for 5GGM)

(-) Sequences/Alignments

NMR Structure
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:146
                                                                                                                                                                                  
               SCOP domains -------------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains -------------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains -------------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ..hhhhhhhhhhhhhhhh.......hhhhhhhhhhh.....hhhhhhhhhhhhh.......hhhhhhhhhhhhhh...hhhhhhhhhhhhh.....eeehhhhhhhhhhh....hhhhhhhhhhhhh.....eeehhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) -------------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE -------------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript -------------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5ggm A   3 QLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGDGTIDFPEFLTMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTAK 148
                                    12        22        32        42        52        62        72        82        92       102       112       122       132       142      

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5GGM)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5GGM)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5GGM)

(-) Gene Ontology  (81, 81)

NMR Structure(hide GO term definitions)

 Visualization

(-) Interactive Views

NMR Structure
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    TB  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5ggm)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5ggm
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_HUMAN | P0DP24
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_HUMAN | P0DP25
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_HUMAN | P0DP24
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_HUMAN | P0DP25
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CALM1_HUMAN | P0DP231aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1wrz 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2i08 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2l7l 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3evv 3ewt 3ewv 3g43 3hr4 3j41 3o77 3o78 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv
        CALM2_HUMAN | P0DP241aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv
        CALM3_HUMAN | P0DP251aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5i0i 5j03 5j8h 5k7l 5k8q 5vms 5wsu 5wsv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5GGM)