Show PDB file:   
         Plain Text   HTML   (compressed file size)
QuickSearch:   
by PDB,NDB,UniProt,PROSITE Code or Search Term(s)  
(-)Asym./Biol. Unit
(-)Asym./Biol. Unit - sites
collapse expand < >
Image Asym./Biol. Unit
Asym./Biol. Unit  (Jmol Viewer)
Image Asym./Biol. Unit - sites
Asym./Biol. Unit - sites  (Jmol Viewer)

(-) Description

Title :  CRYSTAL STRUCTURE OF CALCIUM-LOADED CALMODULIN IN COMPLEX WITH STRA6 CAMBP2-SITE PEPTIDE.
 
Authors :  S. D. Stowe, O. B. Clarke, M. C. Cavalier, R. Godoy-Ruiz, F. Mancia, D. J.
Date :  30 May 16  (Deposition) - 24 Aug 16  (Release) - 07 Sep 16  (Revision)
Method :  X-RAY DIFFRACTION
Resolution :  1.74
Chains :  Asym./Biol. Unit :  A,B
Keywords :  Calmodulin, Stra6, Peptide Complex, Unique Fold, Metal Binding Protein (Keyword Search: [Gene Ontology, PubMed, Web (Google))
 
Reference :  Y. Chen, O. B. Clarke, J. Kim, S. Stowe, Y. K. Kim, Z. Assur, M. Cavalier, R. Godoy-Ruiz, D. C. Von Alpen, C. Manzini, W. S. Blaner, J. Frank, L. Quadro, D. J. Weber, L. Shapiro, W. A. Hendrickson, F. Mancia
Structure Of The Stra6 Receptor For Retinol Uptake.
Science V. 353 2016
PubMed-ID: 27563101  |  Reference-DOI: 10.1126/SCIENCE.AAD8266

(-) Compounds

Molecule 1 - CALMODULIN
    ChainsA
    EngineeredYES
    Expression SystemESCHERICHIA COLI
    Expression System PlasmidPET24
    Expression System StrainBL21(DE3)
    Expression System Taxid469008
    Expression System Vector TypePLASMID
    GeneCALM1, CALM, CAM, CAM1, CALM2, CAM2, CAMB, CALM3, CALML2, CAM3, CAMC, CAMIII
    Organism CommonHUMAN
    Organism ScientificHOMO SAPIENS
    Organism Taxid9606
    SynonymCAM
 
Molecule 2
    ChainsB
    EngineeredYES
    Organism CommonZEBRAFISH
    Organism ScientificDANIO RERIO
    Organism Taxid7955
    Other DetailsCHEMICALLY SYNTHESIZED PEPTIDE WITH N-TERMINAL ACETYLATION AND C-TERMINAL AMIDATION.
    SyntheticYES

 Structural Features

(-) Chains, Units

  12
Asymmetric/Biological Unit AB

Summary Information (see also Sequences/Alignments below)

(-) Ligands, Modified Residues, Ions  (3, 6)

Asymmetric/Biological Unit (3, 6)
No.NameCountTypeFull Name
1CA4Ligand/IonCALCIUM ION
2IMD1Ligand/IonIMIDAZOLE
3NH21Mod. Amino AcidAMINO GROUP

(-) Sites  (5, 5)

Asymmetric Unit (5, 5)
No.NameEvidenceResiduesDescription
1AC1SOFTWAREASP A:129 , ASP A:131 , ASP A:133 , GLN A:135 , GLU A:140 , HOH A:307binding site for residue CA A 201
2AC2SOFTWAREASP A:93 , ASP A:95 , ASN A:97 , TYR A:99 , GLU A:104 , HOH A:368binding site for residue CA A 202
3AC3SOFTWAREASP A:56 , ASP A:58 , ASN A:60 , THR A:62 , GLU A:67 , HOH A:315 , HOH A:346binding site for residue CA A 203
4AC4SOFTWAREASP A:20 , ASP A:22 , ASP A:24 , THR A:26 , GLU A:31 , HOH A:350binding site for residue CA A 204
5AC5SOFTWAREASP A:58 , ASP A:64 , GLU A:67 , GLU A:114 , LEU B:612binding site for residue IMD A 205

(-) SS Bonds  (0, 0)

(no "SS Bond" information available for 5K8Q)

(-) Cis Peptide Bonds  (0, 0)

(no "Cis Peptide Bond" information available for 5K8Q)

 Sequence-Structure Mapping

(-) SAPs(SNPs)/Variants  (0, 0)

(no "SAP(SNP)/Variant" information available for 5K8Q)

(-) PROSITE Motifs  (0, 0)

(no "PROSITE Motif" information available for 5K8Q)

(-) Exons   (0, 0)

(no "Exon" information available for 5K8Q)

(-) Sequences/Alignments

Asymmetric/Biological Unit
   Reformat: Number of residues per line =  ('0' or empty: single-line sequence representation)
  Number of residues per labelling interval =   
  UniProt sequence: complete  aligned part    
   Show mapping: SCOP domains CATH domains Pfam domains Secondary structure (by author)
SAPs(SNPs) PROSITE motifs Exons
(details for a mapped element are shown in a popup box when the mouse pointer rests over it)
Chain A from PDB  Type:PROTEIN  Length:143
                                                                                                                                                                               
               SCOP domains ----------------------------------------------------------------------------------------------------------------------------------------------- SCOP domains
               CATH domains ----------------------------------------------------------------------------------------------------------------------------------------------- CATH domains
               Pfam domains ----------------------------------------------------------------------------------------------------------------------------------------------- Pfam domains
         Sec.struct. author ...hhhhhhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhhhhh..hhhhhhhhhhhh.......hhhhhhhhhhhh....hhhhhhhhhhhhh.......hhhhhhhhhh. Sec.struct. author
                 SAPs(SNPs) ----------------------------------------------------------------------------------------------------------------------------------------------- SAPs(SNPs)
                    PROSITE ----------------------------------------------------------------------------------------------------------------------------------------------- PROSITE
                 Transcript ----------------------------------------------------------------------------------------------------------------------------------------------- Transcript
                 5k8q A   2 DQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLTMMARKMKSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYEEFVQMMTA 147
                                    11        21        31        41        51        61        71     || 84        94       104       114       124       134       144   
                                                                                                      77|                                                                  
                                                                                                       81                                                                  

Chain B from PDB  Type:PROTEIN  Length:27
                                                           
               SCOP domains --------------------------- SCOP domains
               CATH domains --------------------------- CATH domains
               Pfam domains --------------------------- Pfam domains
         Sec.struct. author .hhhhhhhhhhhhhhhhhhhhhh.... Sec.struct. author
                 SAPs(SNPs) --------------------------- SAPs(SNPs)
                    PROSITE --------------------------- PROSITE
                 Transcript --------------------------- Transcript
                 5k8q B 601 SNAKRARAHWQLLYTLVNNPSLVGSRx 627
                                   610       620      |
                                                    627-NH2

   Legend:   → Mismatch (orange background)
  - → Gap (green background, '-', border residues have a numbering label)
    → Modified Residue (blue background, lower-case, 'x' indicates undefined single-letter code, labelled with number + name)
  x → Chemical Group (purple background, 'x', labelled with number + name, e.g. ACE or NH2)
  extra numbering lines below/above indicate numbering irregularities and modified residue names etc., number ends below/above '|'

 Classification and Annotation

(-) SCOP Domains  (0, 0)

(no "SCOP Domain" information available for 5K8Q)

(-) CATH Domains  (0, 0)

(no "CATH Domain" information available for 5K8Q)

(-) Pfam Domains  (0, 0)

(no "Pfam Domain" information available for 5K8Q)

(-) Gene Ontology  (87, 93)

Asymmetric/Biological Unit(hide GO term definitions)

 Visualization

(-) Interactive Views

Asymmetric/Biological Unit
  Complete Structure
    Jena3D(integrated viewing of ligand, site, SAP, PROSITE, SCOP information)
    WebMol | AstexViewer[tm]@PDBe
(Java Applets, require no local installation except for Java; loading may be slow)
    STRAP
(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    RasMol
(require local installation)
    Molscript (VRML)
(requires installation of a VRML viewer; select preferred view via VRML and generate a mono or stereo PDF format file)
 
  Ligands, Modified Residues, Ions
    CA  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    IMD  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
    NH2  [ RasMol | Jena3D ]  +environment [ RasMol | Jena3D ]
 
  Sites
    AC1  [ RasMol ]  +environment [ RasMol ]
    AC2  [ RasMol ]  +environment [ RasMol ]
    AC3  [ RasMol ]  +environment [ RasMol ]
    AC4  [ RasMol ]  +environment [ RasMol ]
    AC5  [ RasMol ]  +environment [ RasMol ]
 
  Cis Peptide Bonds
(no "Cis Peptide Bonds" information available for 5k8q)
 

(-) Still Images

Jmol
  protein: cartoon or spacefill or dots and stick; nucleic acid: cartoon and stick; ligands: spacefill; active site: stick
Molscript
  protein, nucleic acid: cartoon; ligands: spacefill; active site: ball and stick

 Databases and Analysis Tools

(-) Databases

Access by PDB/NDB ID
  5k8q
    Family and Domain InformationProDom | SYSTERS
    General Structural InformationGlycoscienceDB | MMDB | NDB | OCA | PDB | PDBe | PDBj | PDBsum | PDBWiki | PQS | PROTEOPEDIA
    Orientation in MembranesOPM
    Protein SurfaceSURFACE
    Secondary StructureDSSP (structure derived) | HSSP (homology derived)
    Structural GenomicsGeneCensus
    Structural NeighboursCE | VAST
    Structure ClassificationCATH | Dali | SCOP
    Validation and Original DataBMRB Data View | BMRB Restraints Grid | EDS | PROCHECK | RECOORD | WHAT_CHECK
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM2_HUMAN | P0DP24
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  CALM3_HUMAN | P0DP25
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
  F1RAX4_DANRE | F1RAX4
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/TrEMBL
  Q1ECX5_DANRE | Q1ECX5
    Comparative Protein Structure ModelsModBase
    Genomic InformationEnsembl
    Protein-protein InteractionDIP
    Sequence, Family and Domain InformationInterPro | Pfam | SMART | UniProtKB/SwissProt
 
Access by Enzyme Classificator   (EC Number)
  (no 'Enzyme Classificator' available)
    General Enzyme InformationBRENDA | EC-PDB | Enzyme | IntEnz
    PathwayKEGG | MetaCyc
 
Access by Disease Identifier   (MIM ID)
  (no 'MIM ID' available)
    Disease InformationOMIM
 
Access by GenAge ID
  (no 'GenAge ID' available)
    Age Related InformationGenAge

(-) Analysis Tools

Access by PDB/NDB ID
    Domain InformationXDom
    Interatomic Contacts of Structural UnitsCSU
    Ligand-protein ContactsLPC
    Protein CavitiescastP
    Sequence and Secondary StructurePDBCartoon
    Structure AlignmentSTRAP(Java WebStart application, automatic local installation, requires Java; full application with system access!)
    Structure and Sequence BrowserSTING
 
Access by UniProt ID/Accession number
  CALM1_HUMAN | P0DP23
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM2_HUMAN | P0DP24
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  CALM3_HUMAN | P0DP25
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  F1RAX4_DANRE | F1RAX4
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)
  Q1ECX5_DANRE | Q1ECX5
    Protein Disorder PredictionDisEMBL | FoldIndex | GLOBPLOT (for more information see DisProt)

 Related Entries

(-) Entries Sharing at Least One Protein Chain (UniProt ID)

UniProtKB/Swiss-Prot
        CALM1_HUMAN | P0DP231aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1wrz 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2i08 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2l7l 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3evv 3ewt 3ewv 3g43 3hr4 3j41 3o77 3o78 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5vms 5wsu 5wsv
        CALM2_HUMAN | P0DP241aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5vms 5wsu 5wsv
        CALM3_HUMAN | P0DP251aji 1cdl 1cll 1cm1 1cm4 1ctr 1deg 1iwq 1j7o 1j7p 1k90 1k93 1l7z 1lvc 1nkf 1pk0 1qiv 1qiw 1s26 1sk6 1sw8 1up5 1xfu 1xfv 1xfw 1xfx 1xfy 1xfz 1y6w 1yr5 1yrt 1yru 1zot 1zuz 2be6 2f3y 2f3z 2hf5 2jzi 2k0e 2k0f 2k0j 2k61 2kne 2kug 2kuh 2l53 2lgf 2ll6 2ll7 2lqc 2lqp 2lv6 2m0j 2m0k 2m55 2mg5 2n27 2n6a 2n77 2n8j 2r28 2v01 2v02 2vay 2w73 2wel 2x0g 2y4v 3bya 3cln 3dve 3dvj 3dvk 3dvm 3ewt 3ewv 3g43 3hr4 3j41 3oxq 3sui 3uct 3ucw 3ucy 4bw7 4bw8 4byf 4dck 4djc 4gow 4jpz 4jq0 4l79 4lzx 4m1l 4ovn 4q57 4q5u 4umo 4upu 4v0c 5coc 5dbr 5dow 5dsu 5ggm 5i0i 5j03 5j8h 5k7l 5vms 5wsu 5wsv

(-) Related Entries Specified in the PDB File

(no "Related Entries Specified in the PDB File" available for 5K8Q)